Project
Roulette

Tower of Hanoi

Drag the discs yourself, or let it solve the whole thing.

BeginnerWeb appGame5–12hAI-buildable 5/5no setup

The classic puzzle with drag-and-drop, plus an auto-solve that animates the recursive solution move by move. Playing it and then watching the recursion play it is a genuinely good way to understand the algorithm.

UI
Logic
Useful

Hosting · Free forever

Deploys free on GitHub Pages, Cloudflare Pages or Vercel Hobby.

Deploy it and share a link.

Core features · 7

  • Three pegs with a configurable number of discs
  • Discs drag between pegs
  • Illegal moves are rejected with clear feedback
  • Move count shows alongside the known minimum
  • An auto-solve animates the recursive solution
  • Auto-solve can be paused, stepped and resumed
  • A win state triggers when the tower is rebuilt

The interesting part

  • Turning the recursive solution into a pausable step sequence
  • Drag-and-drop that also works by tapping source then destination

Once it works

  • Add undo
  • Show the recursion tree as it solves
  • Add a four-peg variant

Suggested stack

reacttypescripttailwindframer-motion

Track it